Recombinant Full Length Xenopus Laevis 5-Hydroxytryptamine Receptor 7(Htr7) Protein, His-Tagged
Cat.No. : | RFL34812XF |
Product Overview : | Recombinant Full Length Xenopus laevis 5-hydroxytryptamine receptor 7(htr7) Protein (Q91559) (1-425aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-425) |
Form : | Lyophilized powder |
AA Sequence : | MLIQVQPSHLTDTNLSLHSAKPSSDHQNLLPSEFMTERPLNTTEQDLTALNHTEKPDCGK ELLLYGDTEKIVIGVVLSIITLFTIAGNALVIISVCIVKKLRQPSNYLVVSLAAADLSVA VAVMPFVIITDLVGGEWLFGKVFCNVFIAMDVMCCTASIMTLCVISVDRYLGITRPLTYP ARQNGKLMAKMVFIVWLLSASITLPPLFGWAKNVNVERVCLISQDFGYTVYSTAVAFYIP MTVMLVMYQRIFVAAKISAEKHKFVNIPRLYEQEGIYCLEDKLPPKKNSKKKKAVEEFAS LSKLIRQDRKNISIFKREQKAARTLGIIVGAFTFCWLPFFLLSTARPFICGIMCSCMPLR LERTLLWLGYTNSLINPLIYAFFNRDLRTTFWNLLRCKYTNINRRLSAASMHEALKVTER HEGIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | htr7 |
Synonyms | htr7; 5ht7; 5-hydroxytryptamine receptor 7; 5-HT-7; 5-HT7; Serotonin receptor 7 |
UniProt ID | Q91559 |
◆ Recombinant Proteins | ||
HTR7-26031TH | Recombinant Human HTR7, T7 -tagged | +Inquiry |
HTR7-4077C | Recombinant Chicken HTR7 | +Inquiry |
RFL21582HF | Recombinant Full Length Human 5-Hydroxytryptamine Receptor 7(Htr7) Protein, His-Tagged | +Inquiry |
HTR7-2971R | Recombinant Rat HTR7 Protein | +Inquiry |
RFL24475CF | Recombinant Full Length Guinea Pig 5-Hydroxytryptamine Receptor 7(Htr7) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTR7-5330HCL | Recombinant Human HTR7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All htr7 Products
Required fields are marked with *
My Review for All htr7 Products
Required fields are marked with *
0
Inquiry Basket