Recombinant Full Length Xenopus Laevis Apoptosis-Inducing Factor 2(Aifm2) Protein, His-Tagged
| Cat.No. : | RFL10621XF |
| Product Overview : | Recombinant Full Length Xenopus laevis Apoptosis-inducing factor 2(aifm2) Protein (Q6GLW8) (1-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Xenopus laevis |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-374) |
| Form : | Lyophilized powder |
| AA Sequence : | MGSKVSVEESVRVVIVGGGFAGIAAASQLKSFGIPFLLVDMKDAFHHNVAALRACVESGF ARKTFISYKDSFHDSFKQGKVVGINLQTQLVILESNEELSFSHLIIATGSNGPFPGKFNE VISKDQAIQIYENLVEEIQKAKHVVVVGGGSAGVEMAAEVKTDYPEKEVTLIHSKIALAD VQLQPSVRRTVKEILLRKGVRLILAQKVTNLDQVTPNVAQENMELQLDKDSEVVNCDLVL CCIGLKVSSSSYRSALGDKMAEDGSLIVNDYLQVQGHENVYAVGDCAYINEPKMAYYAGI HARVAATNVRNSLIGKSLKSYIPGALSMLLSMGRNDGVGQFNGYYLGRCFVTMAKSRDIF VSKSWKEMGQTMPR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | aifm2 |
| Synonyms | aifm2; Ferroptosis suppressor protein 1; FSP1; Apoptosis-inducing factor homologous mitochondrion-associated inducer of death; AMID; p53-responsive gene 3 protein |
| UniProt ID | Q6GLW8 |
| ◆ Recombinant Proteins | ||
| RFL-31840XF | Recombinant Full Length Xenopus Tropicalis Apoptosis-Inducing Factor 2(Aifm2) Protein, His-Tagged | +Inquiry |
| Aifm2-1260M | Recombinant Mouse Aifm2 Protein, His-tagged | +Inquiry |
| RFL-12462TF | Recombinant Full Length Taeniopygia Guttata Apoptosis-Inducing Factor 2(Aifm2) Protein, His-Tagged | +Inquiry |
| AIFM2-474H | Recombinant Human AIFM2 Protein, GST-tagged | +Inquiry |
| AIFM2-9504H | Recombinant Human AIFM2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AIFM2-8953HCL | Recombinant Human AIFM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All aifm2 Products
Required fields are marked with *
My Review for All aifm2 Products
Required fields are marked with *
