Recombinant Human AIFM2 Protein, GST-tagged

Cat.No. : AIFM2-474H
Product Overview : Human AIFM2 full-length ORF ( NP_116186.1, 1 a.a. - 373 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a flavoprotein oxidoreductase that binds single stranded DNA and is thought to contribute to apoptosis in the presence of bacterial and viral DNA. The expression of this gene is also found to be induced by tumor suppressor protein p53 in colon cancer cells. [provided by RefSeq, Nov 2010]
Molecular Mass : 66.9 kDa
AA Sequence : MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AIFM2 apoptosis-inducing factor, mitochondrion-associated, 2 [ Homo sapiens ]
Official Symbol AIFM2
Synonyms AIFM2; apoptosis-inducing factor, mitochondrion-associated, 2; AMID, apoptosis inducing factor (AIF) like mitochondrion associated inducer of death; apoptosis-inducing factor 2; FLJ14497; PRG3; p53-responsive gene 3 protein; apoptosis-inducing factor (AIF)-like mitochondrion-associated inducer of death; apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer of death; AMID; RP11-367H5.2; DKFZp686L1298;
Gene ID 84883
mRNA Refseq NM_032797
Protein Refseq NP_116186
MIM 605159
UniProt ID Q9BRQ8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AIFM2 Products

Required fields are marked with *

My Review for All AIFM2 Products

Required fields are marked with *

0
cart-icon