Recombinant Human AIFM2 Protein, GST-tagged
Cat.No. : | AIFM2-474H |
Product Overview : | Human AIFM2 full-length ORF ( NP_116186.1, 1 a.a. - 373 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a flavoprotein oxidoreductase that binds single stranded DNA and is thought to contribute to apoptosis in the presence of bacterial and viral DNA. The expression of this gene is also found to be induced by tumor suppressor protein p53 in colon cancer cells. [provided by RefSeq, Nov 2010] |
Molecular Mass : | 66.9 kDa |
AA Sequence : | MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AIFM2 apoptosis-inducing factor, mitochondrion-associated, 2 [ Homo sapiens ] |
Official Symbol | AIFM2 |
Synonyms | AIFM2; apoptosis-inducing factor, mitochondrion-associated, 2; AMID, apoptosis inducing factor (AIF) like mitochondrion associated inducer of death; apoptosis-inducing factor 2; FLJ14497; PRG3; p53-responsive gene 3 protein; apoptosis-inducing factor (AIF)-like mitochondrion-associated inducer of death; apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer of death; AMID; RP11-367H5.2; DKFZp686L1298; |
Gene ID | 84883 |
mRNA Refseq | NM_032797 |
Protein Refseq | NP_116186 |
MIM | 605159 |
UniProt ID | Q9BRQ8 |
◆ Recombinant Proteins | ||
AIFM2-1452M | Recombinant Mouse AIFM2 Protein | +Inquiry |
RFL-10844BF | Recombinant Full Length Bovine Apoptosis-Inducing Factor 2(Aifm2) Protein, His-Tagged | +Inquiry |
Aifm2-1574M | Recombinant Mouse Aifm2 Protein, Myc/DDK-tagged | +Inquiry |
AIFM2-9504H | Recombinant Human AIFM2 protein, GST-tagged | +Inquiry |
AIFM2-956HF | Recombinant Full Length Human AIFM2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AIFM2-8953HCL | Recombinant Human AIFM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AIFM2 Products
Required fields are marked with *
My Review for All AIFM2 Products
Required fields are marked with *
0
Inquiry Basket