Recombinant Human AIFM2 protein, GST-tagged
Cat.No. : | AIFM2-9504H |
Product Overview : | Recombinant Human AIFM2 protein(1-373 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | July 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-373 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 70%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP |
Gene Name | AIFM2 apoptosis-inducing factor, mitochondrion-associated, 2 [ Homo sapiens ] |
Official Symbol | AIFM2 |
Synonyms | AIFM2; apoptosis-inducing factor, mitochondrion-associated, 2; AMID, apoptosis inducing factor (AIF) like mitochondrion associated inducer of death; apoptosis-inducing factor 2; FLJ14497; PRG3; p53-responsive gene 3 protein; apoptosis-inducing factor (AIF)-like mitochondrion-associated inducer of death; apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer of death; AMID; RP11-367H5.2; DKFZp686L1298; |
Gene ID | 84883 |
mRNA Refseq | NM_032797 |
Protein Refseq | NP_116186 |
MIM | 605159 |
UniProt ID | Q9BRQ8 |
◆ Recombinant Proteins | ||
AIFM2-956HF | Recombinant Full Length Human AIFM2 Protein, GST-tagged | +Inquiry |
AIFM2-9504H | Recombinant Human AIFM2 protein, GST-tagged | +Inquiry |
RFL10621XF | Recombinant Full Length Xenopus Laevis Apoptosis-Inducing Factor 2(Aifm2) Protein, His-Tagged | +Inquiry |
RFL-10844BF | Recombinant Full Length Bovine Apoptosis-Inducing Factor 2(Aifm2) Protein, His-Tagged | +Inquiry |
AIFM2-1452M | Recombinant Mouse AIFM2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AIFM2-8953HCL | Recombinant Human AIFM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AIFM2 Products
Required fields are marked with *
My Review for All AIFM2 Products
Required fields are marked with *