Recombinant Full Length Xenopus Laevis Lipoma Hmgic Fusion Partner-Like 3 Protein(Lhfpl3) Protein, His-Tagged
| Cat.No. : | RFL1981XF |
| Product Overview : | Recombinant Full Length Xenopus laevis Lipoma HMGIC fusion partner-like 3 protein(lhfpl3) Protein (Q66IV3) (1-218aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Xenopus laevis |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-218) |
| Form : | Lyophilized powder |
| AA Sequence : | MLSPQEAAKIYHANYIRNSGAIGVLWAIFTICFAIVNIVCFIQPYWIGDGVDTPQAGYFG LFHFCIGSGFSKELTCTGSFTEFSSIPSGAFKAASFFIGLSMTLIIGCIVSFGLFFFCNT ATVYKICAWMQLCSAACLVLGCMIFPDGWDADEVKRMCGEKTDKYSLGACSVRWAYILAI IGILDALILSFLAFVLGNRLDSLMAEQLKLESKDDGNA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | lhfpl3 |
| Synonyms | lhfpl3; LHFPL tetraspan subfamily member 3 protein; Lipoma HMGIC fusion partner-like 3 protein |
| UniProt ID | Q66IV3 |
| ◆ Recombinant Proteins | ||
| LHFPL3-893Z | Recombinant Zebrafish LHFPL3 | +Inquiry |
| RFL20502MF | Recombinant Full Length Mouse Lipoma Hmgic Fusion Partner-Like 3 Protein(Lhfpl3) Protein, His-Tagged | +Inquiry |
| RFL34794HF | Recombinant Full Length Human Lipoma Hmgic Fusion Partner-Like 3 Protein(Lhfpl3) Protein, His-Tagged | +Inquiry |
| Lhfpl3-3781M | Recombinant Mouse Lhfpl3 Protein, Myc/DDK-tagged | +Inquiry |
| LHFPL3-523H | Recombinant Human LHFPL3 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All lhfpl3 Products
Required fields are marked with *
My Review for All lhfpl3 Products
Required fields are marked with *
