Recombinant Full Length Xenopus Laevis Mitochondrial Cardiolipin Hydrolase(Pld6) Protein, His-Tagged
Cat.No. : | RFL2446XF |
Product Overview : | Recombinant Full Length Xenopus laevis Mitochondrial cardiolipin hydrolase(pld6) Protein (A1L1C2) (1-210aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-210) |
Form : | Lyophilized powder |
AA Sequence : | MLLWGRWKLAAGLAGLALSLELFYRYMRRRKPLREVLFFPVPVTCIEPVLSPMKQCSCPLPHTDSAFSRLLVQLLGAQRSLELCVFTFSSPSLARALLILHRRDVRVRVITDNDYMAAPGSQIGPLRSAGVAVRHDQSSGYMHHKFAVVDGTVVLTGSLNWTVQAFQSNKENILITDDTVIVKAYQKEFERLWEEYDPATYNFFPEKENK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pld6 |
Synonyms | pld6; Mitochondrial cardiolipin hydrolase; Choline phosphatase 6; Mitochondrial phospholipase; MitoPLD; Phosphatidylcholine-hydrolyzing phospholipase D6; Phospholipase D6; PLD 6 |
UniProt ID | A1L1C2 |
◆ Recombinant Proteins | ||
PLD6-5546Z | Recombinant Zebrafish PLD6 | +Inquiry |
PLD6-4622H | Recombinant Human PLD6 protein, His-tagged | +Inquiry |
RFL24583BF | Recombinant Full Length Bovine Mitochondrial Cardiolipin Hydrolase(Pld6) Protein, His-Tagged | +Inquiry |
RFL34880CF | Recombinant Full Length Dog Mitochondrial Cardiolipin Hydrolase(Pld6) Protein, His-Tagged | +Inquiry |
PLD6-12937M | Recombinant Mouse PLD6 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All pld6 Products
Required fields are marked with *
My Review for All pld6 Products
Required fields are marked with *