Recombinant Full Length Xenopus Laevis Nedd4 Family-Interacting Protein 1(Ndfip1) Protein, His-Tagged
Cat.No. : | RFL12755XF |
Product Overview : | Recombinant Full Length Xenopus laevis NEDD4 family-interacting protein 1(ndfip1) Protein (Q6GLN5) (1-212aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-212) |
Form : | Lyophilized powder |
AA Sequence : | MSEQSSSSRYQQLQNEEEPGENAQASADAPPPYSSIAGESSGLFDYKDELGFPKPPSYNV ATTLPSYDEAERSKAEATIPLVPGRDDDFVARDDFDDADQLRIGNDGIFMLTFFMAFLFN WIGFFLSFCLTSSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGF LLFLRGFINYAKVRKMPDNFSTLPRTRVLFIY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndfip1 |
Synonyms | ndfip1; NEDD4 family-interacting protein 1 |
UniProt ID | Q6GLN5 |
◆ Recombinant Proteins | ||
NDFIP1-10065Z | Recombinant Zebrafish NDFIP1 | +Inquiry |
NDFIP1-2468H | Recombinant human NDFIP1, His-tagged | +Inquiry |
RFL29755HF | Recombinant Full Length Human Nedd4 Family-Interacting Protein 1(Ndfip1) Protein, His-Tagged | +Inquiry |
RFL7467RF | Recombinant Full Length Rat Nedd4 Family-Interacting Protein 1(Ndfip1) Protein, His-Tagged | +Inquiry |
NDFIP1-3586R | Recombinant Rat NDFIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDFIP1-3935HCL | Recombinant Human NDFIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndfip1 Products
Required fields are marked with *
My Review for All ndfip1 Products
Required fields are marked with *
0
Inquiry Basket