Recombinant Full Length Xenopus Laevis Potassium Channel Subfamily K Member 9(Kcnk9) Protein, His-Tagged
Cat.No. : | RFL3300XF |
Product Overview : | Recombinant Full Length Xenopus laevis Potassium channel subfamily K member 9(kcnk9) Protein (Q63ZI0) (1-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-374) |
Form : | Lyophilized powder |
AA Sequence : | MKRQNVRTLSLIICTFTYLLVGAAVFDALESDYEMREEEKLKAEEIRLKGKYNISSEDYR QLELVIMQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL TLVMFQSLGERMNTFVKYLLKRIKKCCGMHSTDVSMENMVTVGFFSCMGTLCIGAAAFSH YEEWSFFQAYYYCFITLTTIGFGDYVALQKNRALQKKPLYVAFSFMYILVGLTVIGAFLN LVVLRFLTMNSEDERRDAEERASLAGNRNSMIIHIQEDTPHGRQRYKAEVTDLQSVCSCM CYRSHEYTSRMVSHQNSFSSKLNPQYFHSISYKIEEISPSTLKNSLFPSPVSSVSPGLHS FTDKHRLMKRRKSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kcnk9 |
Synonyms | kcnk9; Potassium channel subfamily K member 9 |
UniProt ID | Q63ZI0 |
◆ Recombinant Proteins | ||
KCNK9-6932Z | Recombinant Zebrafish KCNK9 | +Inquiry |
KCNK9-2869R | Recombinant Rat KCNK9 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNK9-3546H | Recombinant Human KCNK9 Protein (Asn240-Val374), N-His tagged | +Inquiry |
RFL35718CF | Recombinant Full Length Guinea Pig Potassium Channel Subfamily K Member 9(Kcnk9) Protein, His-Tagged | +Inquiry |
KCNK9-3213R | Recombinant Rat KCNK9 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All kcnk9 Products
Required fields are marked with *
My Review for All kcnk9 Products
Required fields are marked with *
0
Inquiry Basket