Recombinant Full Length Xenopus Laevis Protein Fam168B(Fam168B) Protein, His-Tagged
Cat.No. : | RFL8341XF |
Product Overview : | Recombinant Full Length Xenopus laevis Protein FAM168B(fam168b) Protein (Q0IHC4) (1-225aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-225) |
Form : | Lyophilized powder |
AA Sequence : | MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYAGPNPAFQQELEHPAHVS SGVQMFMFGHAFSVARNGAIPSGYTPGTPYKVSCSPTSGTVPPYSSSPNPYQTAVYPVRS AYPQQNPYAQQGAYYTQPFYAAPPHVIHHTTVVQPNGMPATMYPAPIQSPRGNGVAMGMV AGTTMAMSAGTLLTSHYPSPVAPQVTMPTYRPPGTPTYSYVPPQW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fam168b |
Synonyms | fam168b; Myelin-associated neurite-outgrowth inhibitor; Mani |
UniProt ID | Q0IHC4 |
◆ Recombinant Proteins | ||
RFL15323MF | Recombinant Full Length Mouse Protein Fam168B(Fam168B) Protein, His-Tagged | +Inquiry |
FAM168B-1410R | Recombinant Rhesus Macaque FAM168B Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM168B-1586R | Recombinant Rhesus monkey FAM168B Protein, His-tagged | +Inquiry |
RFL34893HF | Recombinant Full Length Human Protein Fam168B(Fam168B) Protein, His-Tagged | +Inquiry |
FAM168B-4476Z | Recombinant Zebrafish FAM168B | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM168B-262HCL | Recombinant Human FAM168B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fam168b Products
Required fields are marked with *
My Review for All fam168b Products
Required fields are marked with *
0
Inquiry Basket