Recombinant Full Length Xenopus Laevis Protein Fam198B(Fam198B) Protein, His-Tagged
Cat.No. : | RFL19931XF |
Product Overview : | Recombinant Full Length Xenopus laevis Protein FAM198B(fam198b) Protein (P86275) (1-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-374) |
Form : | Lyophilized powder |
AA Sequence : | MSPDRTGRGSSSSSSSLKRLVCKSFVRAWGRRRPNLRRAVLLICTASAIYGIVIASQVLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fam198b |
Synonyms | gask1b; ened; fam198b; Golgi-associated kinase 1B; Expressed in nerve and epithelium during development; Protein FAM198B; Fragment |
UniProt ID | P86275 |
◆ Recombinant Proteins | ||
FAM198B-5569M | Recombinant Mouse FAM198B Protein | +Inquiry |
FAM198B-3730H | Recombinant Human FAM198B Protein, GST-tagged | +Inquiry |
FAM198B-1422R | Recombinant Rhesus Macaque FAM198B Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM198B-3040M | Recombinant Mouse FAM198B Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM198B-2231R | Recombinant Rat FAM198B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM198B-6390HCL | Recombinant Human FAM198B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All fam198b Products
Required fields are marked with *
My Review for All fam198b Products
Required fields are marked with *
0
Inquiry Basket