Recombinant Full Length Xenopus Laevis Transmembrane Protein 177(Tmem177) Protein, His-Tagged
Cat.No. : | RFL4602XF |
Product Overview : | Recombinant Full Length Xenopus laevis Transmembrane protein 177(tmem177) Protein (Q66IS8) (1-310aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-310) |
Form : | Lyophilized powder |
AA Sequence : | MSSPFLWRFLSFTQKYRGTLLAVSSVGLFAANISYHVAPEQTFRKLYQGWSKGEPVQLTA KLQGLFQEVLEETHMGVTSSYVPFSAFGFHPVSAGIPWLPSGCLIGIPFNYNDTEQDGVG IADRVLLINGKEVDWSSDAGTHLRQALNLSLDAQKFSLAREVFYAQGNSPIIQASAAPVC LSGICLSSVAIKQLLGLYSGPILLRGVYNMAVVVLGFAGYFLCSDAVSQWLDYQSDRKVA AVSKSYATGGIEFYEKILAQNRILRTLMGKQGETMYSPSGNLFPNDYLRLKNAPYTSRRD RIKNALLQME |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem177 |
Synonyms | tmem177; Transmembrane protein 177 |
UniProt ID | Q66IS8 |
◆ Recombinant Proteins | ||
TMEM177-9329M | Recombinant Mouse TMEM177 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM177-6137R | Recombinant Rat TMEM177 Protein | +Inquiry |
RFL4602XF | Recombinant Full Length Xenopus Laevis Transmembrane Protein 177(Tmem177) Protein, His-Tagged | +Inquiry |
RFL2889DF | Recombinant Full Length Danio Rerio Transmembrane Protein 177(Tmem177) Protein, His-Tagged | +Inquiry |
TMEM177-5794R | Recombinant Rat TMEM177 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM177-984HCL | Recombinant Human TMEM177 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tmem177 Products
Required fields are marked with *
My Review for All tmem177 Products
Required fields are marked with *
0
Inquiry Basket