Recombinant Full Length Xenopus Laevis Zinc Transporter 8(Slc30A8) Protein, His-Tagged
Cat.No. : | RFL19048XF |
Product Overview : | Recombinant Full Length Xenopus laevis Zinc transporter 8(slc30a8) Protein (Q5I020) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MKGPEKAYLVSDKATKMYSLTMDSSEKNNCGKPPLQDDENPHIKYHCHNNNTKAYDARQR EQTSAKKKLCIASLICFVFISAEIVGGYIAGSLAVVTDAAHLLVDLSSFFISLGSLWLSS KSSTMRLTFGWYRAEILGALMSIITIWLVTGVLVYLAIERIIRPDYTIDGTVMLITSACA LGANVVLALILHQSGHGHSHAGGKHEHMASEYKPQTNASIRAAFIHVIGDLFQSISVLIS ALIIYFKPEYKIADPICTFIFSIFVLITTVTVLRDLLNILMEGTPRGIHYSDVKQSILAV DGVKSVHSLHLWALTMNQVILSAHIATDILGESKRILKDVTQNVCSSFPFHSVTIQVEPV EEQSPECMFCYEPTQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | slc30a8 |
Synonyms | slc30a8; Zinc transporter 8; ZnT-8; Solute carrier family 30 member 8 |
UniProt ID | Q5I020 |
◆ Recombinant Proteins | ||
SLC30A8-5165R | Recombinant Rat SLC30A8 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC30A8-1216H | Recombinant Human SLC30A8 protein, His-SUMO-tagged | +Inquiry |
Slc30a8-4560M | Recombinant Mouse Slc30a8/ZNT8 protein, His-tagged | +Inquiry |
RFL27184MF | Recombinant Full Length Mouse Zinc Transporter 8(Slc30A8) Protein, His-Tagged | +Inquiry |
RFL19048XF | Recombinant Full Length Xenopus Laevis Zinc Transporter 8(Slc30A8) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC30A8-1737HCL | Recombinant Human SLC30A8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All slc30a8 Products
Required fields are marked with *
My Review for All slc30a8 Products
Required fields are marked with *
0
Inquiry Basket