Recombinant Full Length Xenopus Tropicalis 7-Dehydrocholesterol Reductase(Dhcr7) Protein, His-Tagged
Cat.No. : | RFL3431XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis 7-dehydrocholesterol reductase(dhcr7) Protein (Q6P4M0) (1-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-473) |
Form : | Lyophilized powder |
AA Sequence : | MGERRRANASRGDKKVANGEKPHVGQWGRAWEVDYFSLAAVLFLLAFAPLIVYYFVMSCD QYQCALTAPVLDLYWGKAQLSDIWDKTPALTWGAAKIYIVWVSFQVFLYMLVPDILHKFV PGYEGGVQEGARTPAGLINKYQVNGLQAWTITHLLWFANAYHFHWFSPTIIIDNWVPLLW CANLLGYSVATFALLKAYFFPTNAHDCKFTGNFFYDYMMGIEFNPRIGKWFDFKLFFNGR PGIVAWTLINLSYAAKQQELYGQVTNSMILVNVLQAIYVVDFFWNESWYLKTIDICHDHF GWYLGWGDCVWLPYLYTLQGLYLVYNPVELSTATAVGVLLLGLIGYYIFRMTNHQKDLFR RTNGNCKIWGKKPKSIECSYTSADGKRHYSKLMISGFWGVARHLNYTGDLMGSLAYCLAC GFDHLLPYFYFTYMTILLVHRCIRDEHRCSSKYGKDWKLYTDAVPYRLLPGLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dhcr7 |
Synonyms | dhcr7; 7-dehydrocholesterol reductase; 7-DHC reductase; Sterol Delta(7-reductase |
UniProt ID | Q6P4M0 |
◆ Recombinant Proteins | ||
RFL2095HF | Recombinant Full Length Human 7-Dehydrocholesterol Reductase(Dhcr7) Protein, His-Tagged | +Inquiry |
DHCR7-4340C | Recombinant Chicken DHCR7 | +Inquiry |
DHCR7-2510HF | Recombinant Full Length Human DHCR7 Protein, GST-tagged | +Inquiry |
RFL11704XF | Recombinant Full Length Xenopus Laevis 7-Dehydrocholesterol Reductase(Dhcr7) Protein, His-Tagged | +Inquiry |
DHCR7-479H | Recombinant Human DHCR7 Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHCR7-6949HCL | Recombinant Human DHCR7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All dhcr7 Products
Required fields are marked with *
My Review for All dhcr7 Products
Required fields are marked with *
0
Inquiry Basket