Recombinant Full Length Xenopus Tropicalis Cornichon Homolog 2(Cnih2) Protein, His-Tagged
| Cat.No. : | RFL28053XF |
| Product Overview : | Recombinant Full Length Xenopus tropicalis Cornichon homolog 2(cnih2) Protein (Q0VFK3) (1-162aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-162) |
| Form : | Lyophilized powder |
| AA Sequence : | MAFTFAAFCYMLTLVLCASLIFFIIWHIIAFDELRTDFKNPIEQGNPSRARERVKNVERI CCLLRKLVVPEYCIHGLFCLMFMCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMFDPV SIMNVDILNYCQKEAWCKLAFYLLSFFYYLYRVGATVRYVSA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | cnih2 |
| Synonyms | cnih2; Protein cornichon homolog 2; CNIH-2; Cornichon family AMPA receptor auxiliary protein 2 |
| UniProt ID | Q0VFK3 |
| ◆ Recombinant Proteins | ||
| RFL1656DF | Recombinant Full Length Danio Rerio Protein Cornichon Homolog 2(Cnih2) Protein, His-Tagged | +Inquiry |
| CNIH2-1486R | Recombinant Rat CNIH2 Protein | +Inquiry |
| Cnih2-908M | Recombinant Mouse Cnih2 Protein, MYC/DDK-tagged | +Inquiry |
| CNIH2-1924HF | Recombinant Full Length Human CNIH2 Protein, GST-tagged | +Inquiry |
| CNIH2-1802M | Recombinant Mouse CNIH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNIH2-7409HCL | Recombinant Human CNIH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All cnih2 Products
Required fields are marked with *
My Review for All cnih2 Products
Required fields are marked with *



