Recombinant Full Length Xenopus Tropicalis Inositol Monophosphatase 3(Impad1) Protein, His-Tagged
Cat.No. : | RFL14972XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Inositol monophosphatase 3(impad1) Protein (Q28CL4) (1-356aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-356) |
Form : | Lyophilized powder |
AA Sequence : | MAPMGIRLSPLGIGVFCLLGLGVLYHVYSGFLTGKFSAFLLGDRAEDPGPGEDTVDLREL LAVSVRAAELGGLEVKKVRESNSLNEKAKGKTMEGADDKMTSGDVLSNKKMYHLIKNAFP ALKVNTEEKVEADDEDAVSWDRNIPDDIKEQIKTKHVASESITMWIDPLDATQEYTENLV NYVTTMVCVAVNGKPVIGVIHKPFTGFTAWAMLDGGSSIKKRNSYNEKTPTFIVSRSHSG EVKEVTRQTFGNKTEIISAGGAGYKVLSLLDVTDDKQETADVYIHVTYIKKWDICAGNAI LNALGGQMTTLKGEEIMYTGSELNKGGLLASIGMDHGVLVEKLSEKLQVNAKKPAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | impad1 |
Synonyms | bpnt2; impa3; impad1; TEgg066b01.1; Inositol monophosphatase 3; IMP 3; IMPase 3; 3'(2', 5'-bisphosphate nucleotidase 2; Inositol monophosphatase domain-containing protein 1; Inositol-1(or 4-monophosphatase 3; Myo-inositol monophosphatase A3 |
UniProt ID | Q28CL4 |
◆ Recombinant Proteins | ||
IMPAD1-2087R | Recombinant Rhesus Macaque IMPAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL11675SF | Recombinant Full Length Pig Inositol Monophosphatase 3(Impad1) Protein, His-Tagged | +Inquiry |
IMPAD1-5863HF | Recombinant Full Length Human IMPAD1 Protein, GST-tagged | +Inquiry |
IMPAD1-2266R | Recombinant Rhesus monkey IMPAD1 Protein, His-tagged | +Inquiry |
Impad1-44M | Recombinant Mouse Impad1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IMPAD1-857HCL | Recombinant Human IMPAD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All impad1 Products
Required fields are marked with *
My Review for All impad1 Products
Required fields are marked with *