Recombinant Full Length Xenopus Tropicalis Vacuole Membrane Protein 1(Vmp1) Protein, His-Tagged
Cat.No. : | RFL20456XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Vacuole membrane protein 1(vmp1) Protein (Q68EQ9) (1-406aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-406) |
Form : | Lyophilized powder |
AA Sequence : | MAENGTDCEQRRVGMAKEQNNGSFQDPSFLSDRKSRDREERQSIVLWRKPLITLQYFILE VLITLKDWSIRLWHRRMMVVSVLLLLAVLSVVYYIEGTHQQYVQYVEKKCLWCAYWVGLG ILSSVGLGTGLHTFLLYLGPHIASVTIAAYECNSVNFPEPPYPDEIICPDEEGTEGAISL WTIISKVRLEACMWGAGTAIGELPPYFMARAARLSGVETDDEEYAEFEEMLEHAQTAQDF ATRAKLAVQNLVQKVGFLGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIK MHIQKLFVIITFSKHIVEQMVSLIGVIPSIGPSLQKPFQEYLEAQRKKLHHKEDSGAPQS ENWLSWAFEKLVIIMVFYFILSIINSMAQSYAKRVQQRKLSVEKTK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | vmp1 |
Synonyms | vmp1; Vacuole membrane protein 1 |
UniProt ID | Q68EQ9 |
◆ Recombinant Proteins | ||
VMP1-10052M | Recombinant Mouse VMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL20513MF | Recombinant Full Length Mouse Vacuole Membrane Protein 1(Vmp1) Protein, His-Tagged | +Inquiry |
RFL28500BF | Recombinant Full Length Bovine Vacuole Membrane Protein 1(Vmp1) Protein, His-Tagged | +Inquiry |
VMP1-6528R | Recombinant Rat VMP1 Protein | +Inquiry |
VMP1-6187R | Recombinant Rat VMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VMP1-1794HCL | Recombinant Human VMP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All vmp1 Products
Required fields are marked with *
My Review for All vmp1 Products
Required fields are marked with *
0
Inquiry Basket