Recombinant Full Length Yarrowia Lipolytica Chitobiosyldiphosphodolichol Beta-Mannosyltransferase(Alg1) Protein, His-Tagged
Cat.No. : | RFL28465YF |
Product Overview : | Recombinant Full Length Yarrowia lipolytica Chitobiosyldiphosphodolichol beta-mannosyltransferase(ALG1) Protein (Q6C3K2) (1-463aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yarrowia lipolytica |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-463) |
Form : | Lyophilized powder |
AA Sequence : | MKAWHWSVTLVVIYLAIPVILYLLTRKDDRKPLSDIRKRKRTIVLVLGDLGRSPRMLYHA RSLARSGHKVDLCGYDGAKPFDEILNNDLIKIHHIPLILNTRKLPFVVFGILKVIRQHWL LISLLYKLRGADYLLVQNPPSIPTLGVVRFYNLFLSTRTKVVLDWHNFGYTILALKLPET HPMVKFAKFYEGFFGGRAFVHLCVTVLMGQAMRKTFGMSGRRIVPLHDRPAFHFKPLSES EKLDVLRDFKETLYDDMTADHKIIVSSTSYTPDENFNILLDALALYDESKLDLPPLRVII TGKGPMMPEFLAKVEKLQLKRVSIRTAWLEFADYPRILGAAHLGVSLHESSSGYDLPMKV VDMFGCGIPVVSVDYAALSELVKTNTNGVAVKGHVEMGNTFMSLFSNRGKLDNIKRGAMI ESRNTWDQTWVKTVGPLFDIGEYVQQRPDEDYDFSSSSSDDDH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ALG1 |
Synonyms | ALG1; YALI0E34133g; Chitobiosyldiphosphodolichol beta-mannosyltransferase; Asparagine-linked glycosylation protein 1; Beta-1,4-mannosyltransferase; GDP-Man:GlcNAc2-PP-dolichol mannosyltransferase; GDP-mannose-dolichol diphosphochitobiose mannosyltransfera |
UniProt ID | Q6C3K2 |
◆ Recombinant Proteins | ||
Alg1-1597M | Recombinant Mouse Alg1 Protein, Myc/DDK-tagged | +Inquiry |
ACVR1-8141H | Recombinant Human ACVR1 protein, His-tagged | +Inquiry |
ALG1-1426HF | Recombinant Full Length Human ALG1 Protein, GST-tagged | +Inquiry |
ALG1-461M | Recombinant Mouse ALG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALG1-1540M | Recombinant Mouse ALG1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALG1-8909HCL | Recombinant Human ALG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALG1 Products
Required fields are marked with *
My Review for All ALG1 Products
Required fields are marked with *
0
Inquiry Basket