"GFP" Related Products

Recombinant GFP protein, Arginine/His-tagged

Cat.No. : GFP-83H
Product Overview : Recombinant Enhanced GFP fused with 9 arginine domain / His Tag at C-terminal was expressed in E. coli. Incubating this protein in various culture mediums at 2ug/ ml concentration could be used for monitoring intracellular protein delivery efficiency.
Source : E. coli
Species : Jellyfish Aequorea Victoria
Tag : Arginine/His
Form : 1.0 mg/ml, sterile-filtered, in PBS buffer.
AA Sequence : MGDIMGEWGNEIFGAIAGFLGVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLP VPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGID FKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQ SALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSRHRRHRQRSRSRAAARRRRRRRRR
Purity : >95% by SDS-PAGE
Applications : 9 arginine tag modified GFP protein, which can be used as negative control in any transcription factor protein delivery experiments.
Storage : Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for 30 days.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.