Recombinant Goat GH1 protein
| Cat.No. : | GH1-5321G |
| Product Overview : | Recombinant Goat GH1 protein(P67931)(28-217 aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Goat |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 28-217 aa |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | FPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAP TGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIL ALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKC RRFGEASCAF |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | GH1 growth hormone 1 [ Capra hircus ] |
| Official Symbol | GH1 |
| Synonyms | GH1; growth hormone 1; GH; |
| Gene ID | 100861230 |
| ◆ Recombinant Proteins | ||
| GH1-28093TH | Recombinant Human GH1 protein | +Inquiry |
| GH1-2776H | Recombinant Horse GH1 Protein, His-tagged | +Inquiry |
| GH1-1553H | Recombinant human GH1, Active | +Inquiry |
| GH1-5321G | Recombinant Goat GH1 protein | +Inquiry |
| GH1-240H | Active Recombinant Human GH1 (27-217aa) | +Inquiry |
| ◆ Native Proteins | ||
| GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
| GH1-5354H | Native Human Growth Hormone 1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GH1-5944HCL | Recombinant Human GH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GH1 Products
Required fields are marked with *
My Review for All GH1 Products
Required fields are marked with *
