Recombinant Goat GH1 protein
Cat.No. : | GH1-5324G |
Product Overview : | Recombinant Goat GH1 protein(P67931)(28-217 aa) was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Goat |
Source : | Mammalian cells |
Tag : | Non |
Protein Length : | 28-217 aa |
Form : | Tris/PBS-based buffer, 6% Trehalose. |
AASequence : | FPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAP TGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIL ALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKC RRFGEASCAF |
Purity : | >85% (SDS-PAGE) |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | GH1 growth hormone 1 [ Capra hircus ] |
Official Symbol | GH1 |
Synonyms | GH1; growth hormone 1; GH; |
Gene ID | 100861230 |
◆ Recombinant Proteins | ||
GH1-28093TH | Recombinant Human GH1 protein | +Inquiry |
GH1-5322G | Recombinant Goat GH1 protein, Avi-tagged, Biotinylated | +Inquiry |
GH1-263H | Recombinant Human GH1, StrepII-tagged | +Inquiry |
GH1-109H | Recombinant Human GH1 Protein, His-tagged(C-ter) | +Inquiry |
GH1-4882H | Recombinant Human GH1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
GH1-5354H | Native Human Growth Hormone 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GH1-5944HCL | Recombinant Human GH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GH1 Products
Required fields are marked with *
My Review for All GH1 Products
Required fields are marked with *