Recombinant GST protein
| Cat.No. : | GST-13 |
| Product Overview : | Recombinant GST(1 a.a. - 242 a.a.) was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 1-242 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| AA Sequence : | MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| ◆ Recombinant Proteins | ||
| GST-002S | Recombinant Schistosoma japonicum Glutathione S-transferase, GFP-tagged | +Inquiry |
| GST-2758P | Recombinant Pan-species (General) GST Protein, His-tagged | +Inquiry |
| GST-4708P | Recombinant Plasmodium falciparum GST protein, His-tagged | +Inquiry |
| GST-13 | Recombinant GST protein | +Inquiry |
| GST-112S | Active Recombinant Schistosoma japonicum GST, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CPB-382R | Rabbit anti-GST Polyclonal Antibody | +Inquiry |
| GST-573SCL | Recombinant Schistosoma japonicum GST cell lysate | +Inquiry |
| CPB-278R | Rabbit Anti-GST Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GST Products
Required fields are marked with *
My Review for All GST Products
Required fields are marked with *
