Recombinant GST Protein

• Cat.No.: GST-393
• Product Overview: Recombinant GST Protein without tag was expressed in E. coli.

Specification

• Source: E.coli
• Description: Glutathione S-Transferase (GST), an antioxidant enzyme, is involved in the primary cellular defense mechanism against reactive oxygen species. GST is soluble in water and has a mass of 26.98 kDa. It occurs as a dimer in all aerobic organisms.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Molecular Mass: 26.98kD
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPGIHRD
• Purity: This product is chromatographically purified and predominantly shows a single band during SDS-PAGE.
• Storage: This product is lyophilized in 1 × PBS, and it remains stable for several weeks if stored at 4 centigrade. It may be stored it at -20 centigrade for longer periods.
• Reconstitution: Add 1 ml of dH2O to make the final concentration of 1 mg/ml in 1X PBS

Gene Information

• Official Symbol: GST
• Synonyms: GST; Glutathione S-Transferase