Recombinant GST Protein

Cat.No. : GST-393
Product Overview : Recombinant GST Protein without tag was expressed in E. coli.
Availability August 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E.coli
Description : Glutathione S-Transferase (GST), an antioxidant enzyme, is involved in the primary cellular defense mechanism against reactive oxygen species. GST is soluble in water and has a mass of 26.98 kDa. It occurs as a dimer in all aerobic organisms.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Molecular Mass : 26.98kD
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPGIHRD
Purity : This product is chromatographically purified and predominantly shows a single band during SDS-PAGE.
Storage : This product is lyophilized in 1 × PBS, and it remains stable for several weeks if stored at 4 centigrade. It may be stored it at -20 centigrade for longer periods.
Reconstitution : Add 1 ml of dH2O to make the final concentration of 1 mg/ml in 1X PBS
Official Symbol GST
Synonyms GST; Glutathione S-Transferase

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GST Products

Required fields are marked with *

My Review for All GST Products

Required fields are marked with *

0
cart-icon