| Source : |
E.coli |
| Description : |
Glutathione S-Transferase (GST), an antioxidant enzyme, is involved in the primary cellular defense mechanism against reactive oxygen species. GST is soluble in water and has a mass of 26.98 kDa. It occurs as a dimer in all aerobic organisms. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Molecular Mass : |
26.98kD |
| AA Sequence : |
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPGIHRD |
| Purity : |
This product is chromatographically purified and predominantly shows a single band during SDS-PAGE. |
| Storage : |
This product is lyophilized in 1 × PBS, and it remains stable for several weeks if stored at 4 centigrade. It may be stored it at -20 centigrade for longer periods. |
| Reconstitution : |
Add 1 ml of dH2O to make the final concentration of 1 mg/ml in 1X PBS |