Recombinant GST Protein
| Cat.No. : | GST-393 |
| Product Overview : | Recombinant GST Protein without tag was expressed in E. coli. |
| Availability | January 24, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Description : | Glutathione S-Transferase (GST), an antioxidant enzyme, is involved in the primary cellular defense mechanism against reactive oxygen species. GST is soluble in water and has a mass of 26.98 kDa. It occurs as a dimer in all aerobic organisms. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Molecular Mass : | 26.98kD |
| AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPGIHRD |
| Purity : | This product is chromatographically purified and predominantly shows a single band during SDS-PAGE. |
| Storage : | This product is lyophilized in 1 × PBS, and it remains stable for several weeks if stored at 4 centigrade. It may be stored it at -20 centigrade for longer periods. |
| Reconstitution : | Add 1 ml of dH2O to make the final concentration of 1 mg/ml in 1X PBS |
| Publications : |
| Official Symbol | GST |
| Synonyms | GST; Glutathione S-Transferase |
| ◆ Recombinant Proteins | ||
| GST-2759P | Recombinant Pan-species (General) GST Protein, N-GST-tagged | +Inquiry |
| GST-2758P | Recombinant Pan-species (General) GST Protein, His-tagged | +Inquiry |
| GST-1268S | Recombinant Schistosoma japonicum GST protein(Met1-Lys218) | +Inquiry |
| GST-13 | Recombinant GST protein | +Inquiry |
| GST-4708P | Recombinant Plasmodium falciparum GST protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CPB-382R | Rabbit anti-GST Polyclonal Antibody | +Inquiry |
| GST-573SCL | Recombinant Schistosoma japonicum GST cell lysate | +Inquiry |
| CPB-278R | Rabbit Anti-GST Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GST Products
Required fields are marked with *
My Review for All GST Products
Required fields are marked with *
