Recombinant GST Protein
Cat.No. : | GST-393 |
Product Overview : | Recombinant GST Protein without tag was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Description : | Glutathione S-Transferase (GST), an antioxidant enzyme, is involved in the primary cellular defense mechanism against reactive oxygen species. GST is soluble in water and has a mass of 26.98 kDa. It occurs as a dimer in all aerobic organisms. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Molecular Mass : | 26.98kD |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPGIHRD |
Purity : | This product is chromatographically purified and predominantly shows a single band during SDS-PAGE. |
Storage : | This product is lyophilized in 1 × PBS, and it remains stable for several weeks if stored at 4 centigrade. It may be stored it at -20 centigrade for longer periods. |
Reconstitution : | Add 1 ml of dH2O to make the final concentration of 1 mg/ml in 1X PBS |
Official Symbol | GST |
Synonyms | GST; Glutathione S-Transferase |
◆ Recombinant Proteins | ||
GST-5835P | Recombinant Plasmodium falciparum GST protein, His-tagged | +Inquiry |
GST-113 | Active Recombinant Glutathione S-Transferase | +Inquiry |
GST-13 | Recombinant GST protein | +Inquiry |
GST-52 | Recombinant GST-alpha Spectrin | +Inquiry |
GST-8543S | Recombinant Schistosoma japonicum GST Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPB-382R | Rabbit anti-GST Polyclonal Antibody | +Inquiry |
CPB-278R | Rabbit Anti-GST Polyclonal Antibody | +Inquiry |
GST-573SCL | Recombinant Schistosoma japonicum GST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GST Products
Required fields are marked with *
My Review for All GST Products
Required fields are marked with *
0
Inquiry Basket