Recombinant HAdV-5 DBP protein, His-tagged
| Cat.No. : | DBP-2298H |
| Product Overview : | Recombinant HAdV-5 DBP protein(P03265)(174-529aa), fused to N-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | HAdV-5 |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 174-529aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.3 kDa |
| AA Sequence : | SVPIVSAWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEALAAVCKTWLNEEHRGLQLTFTSKKTFVTMMGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEIEGELKCLHGSIMINKEHVIEMDVTSENGQRALKEQSSKAKIVKNRWGRNVVQISNTDARCCVHDAACPANQFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNAQTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPFALSNAEDLDADLISDKSVLASVHHPALIVFQCCNPVYRNSRAQGGGPNCDFKISAPDLLNALVMVRSLWSENFTELPRMVVPEFKWSTKHQYRNVSLPVAHSDARQNPFDF |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| ◆ Recombinant Proteins | ||
| DBP-2607HF | Recombinant Full Length Human DBP Protein, GST-tagged | +Inquiry |
| DBP-893H | Recombinant Human DBP Protein, His-tagged | +Inquiry |
| DBP-4224H | Recombinant Human adenovirus C serotype 2 DBP protein, His-tagged | +Inquiry |
| DBP-1005R | Recombinant Rhesus Macaque DBP Protein, His (Fc)-Avi-tagged | +Inquiry |
| DBP-1784R | Recombinant Rat DBP Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DBP-7062HCL | Recombinant Human DBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DBP Products
Required fields are marked with *
My Review for All DBP Products
Required fields are marked with *
