Recombinant HCoV-HKU1(isolate N1) N Protein(1-441aa), His&Myc-tagged
Cat.No. : | N-1811V |
Product Overview : | Recombinant HCoV-HKU1(isolate N1) N Protein(1-441aa)(Q5MQC6), fused with N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HCoV-HKU1 |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 1-441aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 53kDa |
AA Sequence : | MSYTPGHYAGSRSSSGNRSGILKKTSWADQSERNYQTFNRGRKTQPKFTVSTQPQGNTIPHYSWFSGITQFQKGRDFKFSDGQGVPIAFGVPPSEAKGYWYRHSRRSFKTADGQQKQLLPRWYFYYLGTGPYANASYGESLEGVFWVANHQADTSTPSDVSSRDPTTQEAIPTRFPPGTILPQGYYVEGSGRSASNSRPGSRSQSRGPNNRSLSRSNSNFRHSDSIVKPDMADEIANLVLAKLGKDSKPQQVTKQNAKEIRHKILTKPRQKRTPNKHCNVQQCFGKRGPSQNFGNAEMLKLGTNDPQFPILAELAPTPGAFFFGSKLDLVKRDSEADSPVKDVFELHYSGSIRFDSTLPGFETIMKVLEENLNAYVNSNQNTDSDSLSSKPQRKRGVKQLPEQFDSLNLSAGTQHISNDFTPEDHSLLATLDDPYVEDSVA |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
◆ Recombinant Proteins | ||
N-239V | Recombinant HCoV-NL63 N protein, His-tagged | +Inquiry |
N-5590L | Recombinant LASV N protein, His-tagged | +Inquiry |
N-3889V | Recombinant Vaccinia virus N protein, His-SUMO-tagged | +Inquiry |
N-203V | Recombinant COVID-19 N protein, His-tagged | +Inquiry |
N-4326V | Recombinant COVID-19 N Protein(1-419aa), His-sumostar-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NP-002HCL | Recombinant H3N2 NP cell lysate | +Inquiry |
NP-001SCL | Recombinant SARS NP cell lysate | +Inquiry |
NP-005HCL | Recombinant H7N9 NP cell lysate | +Inquiry |
NP-479HCL | Recombinant H2N2 NP cell lysate | +Inquiry |
NP-001HCL | Recombinant H1N1 NP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NP Products
Required fields are marked with *
My Review for All NP Products
Required fields are marked with *