Recombinant HCoV-NL63 N Protein, His-SUMO-tagged(N-ter)

Species :	HCoV-NL63
Source :	HEK293
Tag :	His&SUMO
Description :	Coronaviruses are named for the crown-like spikes on their surface. There are four main sub-groupings of coronaviruses, known as 229E (alpha coronavirus), NL63 (alpha coronavirus), OC43 (beta coronavirus), HKU1 (beta coronavirus).
Form :	Powder
AA Sequence :	MASVNWADDRAARKKFPPPSFYMPLLVSSDKAPYRVIPRNLVPIGKGNKDEQIGYWNVQERWRMRRGQRVDLPPKVHFYYLGTGPHKDLKFRQRSDGVVWVAKEGAKTVNTSLGNRKRNQKPLEPKFSIALPPELSVVEFEDRSNNSSRASSRSSTRNNSRDSSRSTSRQQSRTRSDSNQSSSDLVAAVTLALKNLGFDNQSKSPSSSGTSTPKKPNKPLSQPRADKPSQLKKPRWKRVPTREENVIQCFGPRDFNHNMGDSDLVQNGVDAKGFPQLAELIPNQAALFFDSEVSTDEVGDNVQITYTYKMLVAKDNKNLPKFIEQISAFTKPSSIKEMQSQSSHVAQNTVLNASIPESKPLADDDSAIIEIVNEVLH
Endotoxin :	Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity :	> 95% (by SDS-PAGE)
Applications :	SDS-PAGE
Notes :	For laboratory research only, not for drug, diagnostic or other use.
Storage :	Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer :	PBS (pH 7.4)
Reconstitution :	It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Name	N nucleocapsid protein [ Human coronavirus NL63 ]
Official Symbol	N
Synonyms	N; nucleocapsid protein; nucleocapsid protein; nucleoprotein
Gene ID	2943504
Protein Refseq	YP_003771
UniProt ID	Q6Q1R8