Recombinant Hepatitis C Virus Nucleocapsid (core, 1-120), N-His-tagged

Cat.No. : N-05H
Product Overview : Recombinant HCV Core 1-120 produced in E. coli is a single polypeptide chain containing 140 amino acids (aa 1-120). Recombinant HCV Core 1-120 is fused to a 20 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : HCV
Source : E.coli
Tag : His
Protein Length : 1-120
Description : HCV is a small 50nm, enveloped, single-stranded, positive sense RNA virus in the family Flaviviridae. HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes.
Form : Sterile filtered colorless solution.
Molecular Mass : 15.7 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRPEGRTWAQPGYPWPLYGNEGCGWAGWLLSPRGSRPSWGPTDPRRRSRNLG.
Purity : Greater than 85% as determined by SDS-PAGE.
Usage : Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Storage : Store at 4 centigrade if entire vial will be used within 2-4 weeks. Store, frozen at -20 centigrade for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Concentration : 0.5 mg/mL
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0), 0.4M Urea and 10% glycerol.
Shipping : Shipped with Ice Packs
Official Symbol N
Synonyms Nucleocapsid; N; HCV; HCV nucleocapsid; Hepatitis C virus

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NP Products

Required fields are marked with *

My Review for All NP Products

Required fields are marked with *

0
cart-icon