Recombinant HHV-6 variant A(strain Uganda-1102) gB protein, His&Myc-tagged
Cat.No. : | gB-4266H |
Product Overview : | Recombinant HHV-6 variant A(strain Uganda-1102) gB protein(P28864)(23-188aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HHV-6 variant A |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 23-188aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.8 kDa |
AA Sequence : | DPDHYIRAGYNHKYPFRICSIAKGTDLMRFDRDISCSPYKSNAKMSEGFFIIYKTNIETYTFPVRTYKKELTFQSSYRDVGVVYFLDRTVMGLAMPVYEANLVNSHAQCYSAVAMKRPDGTVFSAFHEDNNKNNTLNLFPLNFKSITNKRFITTKEPYFARGPLWL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
GB-18H | Recombinant HCMV Glycoprotein B (GB) protein, Fc-tagged | +Inquiry |
gB-500V | Recombinant HSV 2(strain 333) gB protein(Glu98-Ala730), His-tagged | +Inquiry |
gB-4055H | Recombinant Human herpesvirus 7 gB protein, His-tagged | +Inquiry |
gB-1698V | Recombinant VZV gB Protein | +Inquiry |
gB-0297C | Recombinant CMV gB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GB-2601CCL | Recombinant CMV GB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All gB Products
Required fields are marked with *
My Review for All gB Products
Required fields are marked with *