Recombinant Hmuan WFDC2 protein

Cat.No. : WFDC2-663H
Product Overview : Recombinant Human WFDC2 protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 94
Description : This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation.
Form : Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.0.
Molecular Mass : Approximately 10.0 kDa, a single polypeptide chain containing 94 amino acids. But it migrates with an apparent molecular mass of 16.9 kDa in SDS-PAGE.
AA Sequence : EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Endotoxin : Less than 1.0 EU/µg of rHE4 as determined by LAL method.
Purity : >95% by SDS-PAGE.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name WFDC2
Official Symbol WFDC2
Synonyms WFDC2; WAP four-disulfide core domain 2; WAP four-disulfide core domain protein 2; dJ461P17.6; EDDM4; epididymal protein 4; HE4; WAP5; epididymal secretory protein E4; putative protease inhibitor WAP5; WAP domain containing protein HE4-V4; major epididymis-specific protein E4; epididymis-specific, whey-acidic protein type, four-disulfide core; MGC57529;
Gene ID 10406
mRNA Refseq NM_006103
Protein Refseq NP_006094
MIM 617548
UniProt ID Q14508

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WFDC2 Products

Required fields are marked with *

My Review for All WFDC2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon