Recombinant Hmuan WFDC2 protein
Cat.No. : | WFDC2-663H |
Product Overview : | Recombinant Human WFDC2 protein was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 94 |
Description : | This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. |
Form : | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.0. |
Molecular Mass : | Approximately 10.0 kDa, a single polypeptide chain containing 94 amino acids. But it migrates with an apparent molecular mass of 16.9 kDa in SDS-PAGE. |
AA Sequence : | EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF |
Endotoxin : | Less than 1.0 EU/µg of rHE4 as determined by LAL method. |
Purity : | >95% by SDS-PAGE. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | WFDC2 |
Official Symbol | WFDC2 |
Synonyms | WFDC2; WAP four-disulfide core domain 2; WAP four-disulfide core domain protein 2; dJ461P17.6; EDDM4; epididymal protein 4; HE4; WAP5; epididymal secretory protein E4; putative protease inhibitor WAP5; WAP domain containing protein HE4-V4; major epididymis-specific protein E4; epididymis-specific, whey-acidic protein type, four-disulfide core; MGC57529; |
Gene ID | 10406 |
mRNA Refseq | NM_006103 |
Protein Refseq | NP_006094 |
MIM | 617548 |
UniProt ID | Q14508 |
◆ Recombinant Proteins | ||
WFDC2-281H | Recombinant Human WFDC2 Protein, His-tagged | +Inquiry |
WFDC2-2356H | Recombinant Human WFDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
WFDC2-2662H | Recombinant Human WFDC2 protein, His-tagged | +Inquiry |
WFDC2-649HFL | Recombinant Full Length Human WFDC2 Protein, C-Flag-tagged | +Inquiry |
WFDC2-5532H | Recombinant Human WFDC2 Protein (Glu31-Phe124), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WFDC2-1266CCL | Recombinant Canine WFDC2 cell lysate | +Inquiry |
WFDC2-2056HCL | Recombinant Human WFDC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WFDC2 Products
Required fields are marked with *
My Review for All WFDC2 Products
Required fields are marked with *
0
Inquiry Basket