Recombinant Horse FST protein(30-344aa), His-tagged
Cat.No. : | FST-498H |
Product Overview : | Recombinant Horse FST protein(O62650)(30-344aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Horse |
Source : | HEK293 |
Tag : | His |
Protein Length : | 30-344aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCDNVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVNCPGSSTCVVDQTNNAYCVTCNRICPEPTSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSEEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW |
Gene Name | FST follistatin [ Equus caballus ] |
Official Symbol | FST |
Synonyms | FST; follistatin; FS; activin-binding protein; |
Gene ID | 100033825 |
mRNA Refseq | NM_001081811 |
Protein Refseq | NP_001075280 |
◆ Recombinant Proteins | ||
FST-1551H | Recombinant human FST, Active | +Inquiry |
FST-498H | Recombinant Horse FST protein(30-344aa), His-tagged | +Inquiry |
FST-2054R | Recombinant Rat FST Protein, His (Fc)-Avi-tagged | +Inquiry |
Fst-8663M | Recombinant Mouse Fst, Fc tagged | +Inquiry |
FST-2557H | Recombinant Human FST Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
FST-001H | Recombinant Human FST Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FST-1833HCL | Recombinant Human FST cell lysate | +Inquiry |
FST-001MCL | Recombinant Mouse FST cell lysate | +Inquiry |
FST-1771MCL | Recombinant Mouse FST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FST Products
Required fields are marked with *
My Review for All FST Products
Required fields are marked with *