Recombinant Horse PMP2 Protein (2-132 aa), His-SUMO-tagged
| Cat.No. : | PMP2-1793H |
| Product Overview : | Recombinant Horse PMP2 Protein (2-132 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Horse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-132 aa |
| Description : | May play a role in lipid transport protein in Schwann cells. May bind cholesterol. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 30.4 kDa |
| AA Sequence : | SNKFLGTWKLTSSENFDEYMKALGVGLGTRSLGNLAGPTVIISKSGDVITIRTESGFKNTEISFKLGQEFEETTADNRKTKSTVTLAGGKLNQVQKWNGNETTIKRELVDGKMVVECSMASVVCTRIYEQV |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Synonyms | PMP2; |
| UniProt ID | P0C6G6 |
| ◆ Recombinant Proteins | ||
| PMP2-6713HFL | Recombinant Full Length Human PMP2 protein, Flag-tagged | +Inquiry |
| PMP2-13016M | Recombinant Mouse PMP2 Protein | +Inquiry |
| PMP2-3303R | Recombinant Rhesus Macaque PMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PMP2-656H | Recombinant Human PMP2 protein, MYC/DDK-tagged, C13/N15-labeled | +Inquiry |
| PMP2-3058H | Recombinant Human PMP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PMP2-3086HCL | Recombinant Human PMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PMP2 Products
Required fields are marked with *
My Review for All PMP2 Products
Required fields are marked with *
