Recombinant HPV-11 E7 Protein, His&Myc-tagged
Cat.No. : | E7-01H |
Product Overview : | Recombinant HPV-11 E7 Protein(P04020)(1-98aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | HPV11 |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-98aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.3 kDa |
AA Sequence : | MHGRLVTLKDIVLDLQPPDPVGLHCYEQLEDSSEDEVDKVDKQDAQPLTQHYQILTCCCGCDSNVRLVVECTDGDIRQLQDLLLGTLNIVCPICAPKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
◆ Recombinant Proteins | ||
E7-4032H | Recombinant Human papillomavirus type 52 E7 protein, His-SUMO-tagged | +Inquiry |
E7-1694H | Recombinant HPV-6 E7 Protein, His tagged | +Inquiry |
E7-01H | Recombinant HPV-11 E7 Protein, His&Myc-tagged | +Inquiry |
E7-5703H | Recombinant Human papillomavirus type 18 E7 protein, His-tagged | +Inquiry |
E7-1688H | Recombinant HPV-16 E7 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All E7 Products
Required fields are marked with *
My Review for All E7 Products
Required fields are marked with *