Recombinant HPV-16 E6 Full Length protein, His-tagged
Cat.No. : | E6-37H |
Product Overview : | Recombinant HPV-16 E6 Full Length protein(P03126)(1-158aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human papillomavirus type 16 |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-158aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
Molecular Mass : | 21.2 kDa |
AASequence : | MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
E6-1684H | Recombinant HPV-34 E6 Protein | +Inquiry |
E6-3996H | Recombinant Human papillomavirus type 52 E6 protein, His-SUMO-tagged | +Inquiry |
E6-02P | Recombinant HPV16 E6 Protein, His-tagged | +Inquiry |
E6-5678H | Recombinant Human E6 protein, His&His-tagged | +Inquiry |
E6-01H | Recombinant HPV-11 E6 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All E6 Products
Required fields are marked with *
My Review for All E6 Products
Required fields are marked with *
0
Inquiry Basket