Recombinant HPV-16 E6 Full Length protein, His-tagged
| Cat.No. : | E6-37H |
| Product Overview : | Recombinant HPV-16 E6 Full Length protein(P03126)(1-158aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human papillomavirus type 16 |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-158 aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Molecular Mass : | 21.2 kDa |
| AASequence : | MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| ◆ Recombinant Proteins | ||
| E6-470V | Recombinant Human PapillomaVirus E6 Protein, His-tagged | +Inquiry |
| E6-1684H | Recombinant HPV-34 E6 Protein | +Inquiry |
| E6-1682H | Recombinant HPV18 E6 Protein, His-tagged | +Inquiry |
| E6-14H | Recombinant HPV16 E6 Protein, His tagged | +Inquiry |
| E6-1683H | Recombinant HPV-26 E6 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (1)
- Q&As (0)
Customer Reviews
Write a reviewReviews
10/13/2025
The Recombinant HPV-16 E6 Protein has been working well for our purposes, and we would like to place a second order for the same amount.
Ask a Question for All E6 Products
Required fields are marked with *
My Review for All E6 Products
Required fields are marked with *
