Recombinant HPV-11 E7 Protein
| Cat.No. : | VAng-Wyb3012 |
| Product Overview : | Recombinant HPV-11 E7 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | HPV11 |
| Source : | E.coli |
| Tag : | Non |
| Form : | 10 mM Tris-HCl, 1 mM EDTA, pH 8.0, 50% glycerol. |
| Molecular Mass : | ~ 18.3 kDa |
| AA Sequence : | MHGRLVTLKDIVLDLQPPDPVGLHCYEQLEDSSEDEVDKVDKQDAQPLTQHYQILTCCCGCDSNVRLVVECTDGDIRQLQDLLLGTLNIVCPICAPKP |
| Purity : | ≥90%, by SDS-PAGE |
| Stability : | -20 to -80°C, six months from the date of receipt |
| Storage : | Store at -20℃, for extended storage, conserve at -20°C or -80°C. Avoid freeze/thaw cycles. |
| Concentration : | 1.0 mg/ml |
| ◆ Recombinant Proteins | ||
| VAng-Wyb3012 | Recombinant HPV-11 E7 Protein | +Inquiry |
| VAng-Wyb3388 | Recombinant HPV-6a E5 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VAng Products
Required fields are marked with *
My Review for All VAng Products
Required fields are marked with *
