Recombinant HPV-6a E5 Protein
Cat.No. : | E5-12V |
Product Overview : | Recombinant HPV-6a E5 Protein wihtout tag was expressed in E. coli. |
Availability | June 27, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | HPV6 |
Source : | E.coli |
Description : | HPV infection is a viral infection that commonly causes skin or mucous membrane growths (warts). There are more than 100 varieties of human papillomavirus (HPV). Some types of HPVinfection cause warts, and some can cause different types of cancer. |
Molecular Mass : | 17.8 kDa |
AA Sequence : | MEVVPVQIAAGTTSTLILPVIIAFVVCFVSIILIVWISDFIVYTSVLVLTLLLYLLLWLLLTTPLQFFLLTLLVCYCPALYIHHYIVNTQQ |
Purity : | ≥85 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0. The volume before lyophilization is 50 μL/vial. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Official Symbol | E5 |
Synonyms | E5; HPV-6a E5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All E5 Products
Required fields are marked with *
My Review for All E5 Products
Required fields are marked with *