Recombinant HRSV GP Protein, His-tagged
Cat.No. : | GP-762H |
Product Overview : | Recombinant HRSV GP protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HRSV |
Source : | HEK293 |
Tag : | His |
Protein Length : | 298 |
Description : | Virion membrane; Peripheral membrane protein. |
Form : | Lyophilized |
Molecular Mass : | 26.2 kDa |
AA Sequence : | MSKNKDQRTAKTLEKTWDTLNHLLFISSGLYKLNLKSIAQITLSILAMIISTSLIITAIIFIASANHKVTLTTAIIQDATSQIKNTTPTYLTQDPQLGISFSNLSEITSQTTTILASTTPGVKSNLQPTTVKTKNTTTTQTQPSKPTTKQRQNKPPNKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTFKTTKKDHKPQTTKPKEVPTTKPTEEPTINTTKTNIITTLLTNNTTGNPKLTSQMETFHSTSSEGNLSPSQVSTTSEHPSQPSSPPNTTRQ |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Official Symbol | GP |
Synonyms | G; GP; Glycoprotein |
◆ Cell & Tissue Lysates | ||
GLYCOPROTEIN-001SCL | Recombinant Sudan ebolavirus GLYCOPROTEIN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GP Products
Required fields are marked with *
My Review for All GP Products
Required fields are marked with *
0
Inquiry Basket