Recombinant HTLV-1 gp46 protein, His-tagged
| Cat.No. : | GB46-01VH |
| Product Overview : | Recombinant HTLV-1 gp46 protein, fused to His-tag, was expressed in HEK293. |
| Availability | August 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | HTLV1 |
| Source : | HEK293 |
| Tag : | His |
| Form : | PBS, pH7.4 |
| Molecular Mass : | The protein has a calculated MW of 32.2 kDa. |
| AA Sequence : | SCCTLTIGVSSYHSKPCNPAQPVCSWTLDLLALSADQALQPPCPNLVSYSSYHATYSLYLFPHWTKKPNRNGGGYYSASYSDPCSLKCPYLGCQSWTCPYTGAVSSPYWKFQHDVNFTQEVSRLNINLHFSKCGFPFSLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTLQSTNYTCIVCIDRASLSTWHVLYSPNVSVPSSSSTPLLYPSLALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLILPPFSLSPVPTLGSHHHHHH |
| Purity : | >90%,by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.63 mg/ml |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GB46 Products
Required fields are marked with *
My Review for All GB46 Products
Required fields are marked with *



