Recombinant Human AAK1 Protein, GST-tagged
Cat.No. : | AAK1-017H |
Product Overview : | Human AAK1 full-length ORF ( AAH02695.1, 1 a.a. - 474 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Adaptor-related protein complex 2 (AP-2 complexes) functions during receptor-mediated endocytosis to trigger clathrin assembly, interact with membrane-bound receptors, and recruit encodytic accessory factors. This gene encodes a member of the SNF1 subfamily of Ser/Thr protein kinases. The protein interacts with and phosphorylates a subunit of the AP-2 complex, which promotes binding of AP-2 to sorting signals found in membrane-bound receptors and subsequent receptor endocytosis. Its kinase activity is stimulated by clathrin. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 78.4 kDa |
AA Sequence : | MKKFFDSRREQGGSGLGSGSSGGGGSTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKARLTDPIPTTETSIAPRQRPKAGQTQPNPGILPIQPALTPRKRATVQPPPQAAGSSNQPGLLASVPQPKPQAPPSQPLPQTQAKQPQAPPTPQQTPSTQAQGLPAQAQATPQHQQHTIKLSMKL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AAK1 AP2 associated kinase 1 [ Homo sapiens ] |
Official Symbol | AAK1 |
Synonyms | AAK1; AP2 associated kinase 1; AP2-associated protein kinase 1; DKFZp686K16132; KIAA1048; adaptor-associated kinase 1; FLJ23712; FLJ25931; FLJ31060; FLJ42882; FLJ45252; MGC138170; MGC164568; MGC164570; DKFZp686F03202; |
Gene ID | 22848 |
mRNA Refseq | NM_014911 |
Protein Refseq | NP_055726 |
UniProt ID | Q2M2I8 |
◆ Recombinant Proteins | ||
AAK1-018H | Recombinant Human AAK1 Protein, GST-tagged | +Inquiry |
AAK1-750HF | Recombinant Full Length Human AAK1 Protein, GST-tagged | +Inquiry |
AAK1-3547B | Recombinant Bovine AAK1, His-tagged | +Inquiry |
AAK1-893H | Recombinant Active Human AAK1 Protein (1-465), N-GST tagged | +Inquiry |
Aak1-3546R | Recombinant Rat Aak1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AAK1-2106HCL | Recombinant Human AAK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AAK1 Products
Required fields are marked with *
My Review for All AAK1 Products
Required fields are marked with *