Recombinant Human AAMP protein, GST-tagged
Cat.No. : | AAMP-1799H |
Product Overview : | Recombinant Human AAMP protein(85-434 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 85-434 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | VTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIRIWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSATTGKVVGVFRPETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLATQTLRHQCQHQSGIVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFALSKDASLVVTTSGDHKAKVFCVQRPDR |
Gene Name | AAMP angio-associated, migratory cell protein [ Homo sapiens ] |
Official Symbol | AAMP |
Synonyms | AAMP; angio-associated, migratory cell protein; angio-associated migratory cell protein; |
Gene ID | 14 |
mRNA Refseq | NM_001087 |
Protein Refseq | NP_001078 |
MIM | 603488 |
UniProt ID | Q13685 |
◆ Recombinant Proteins | ||
ACAA1-251H | Recombinant Human ACAA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACAA1-870HF | Recombinant Full Length Human ACAA1 Protein, GST-tagged | +Inquiry |
ACAA1-1167HFL | Recombinant Full Length Human ACAA1 Protein, C-Flag-tagged | +Inquiry |
ACAA1-4171C | Recombinant Chicken ACAA1 | +Inquiry |
ACAA1-408H | Recombinant Human ACAA1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACAA1-9119HCL | Recombinant Human ACAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACAA1 Products
Required fields are marked with *
My Review for All ACAA1 Products
Required fields are marked with *
0
Inquiry Basket