Recombinant Human AANAT Protein, GST-tagged

Cat.No. : AANAT-021H
Product Overview : Human AANAT partial ORF ( NP_001079.1, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the acetyltransferase superfamily. It is the penultimate enzyme in melatonin synthesis and controls the night/day rhythm in melatonin production in the vertebrate pineal gland. Melatonin is essential for the function of the circadian clock that influences activity and sleep. This enzyme is regulated by cAMP-dependent phosphorylation that promotes its interaction with 14-3-3 proteins and thus protects the enzyme against proteasomal degradation. This gene may contribute to numerous genetic diseases such as delayed sleep phase syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]
Molecular Mass : 34.43 kDa
AA Sequence : MSTQSTHPLKPEAPRLPPGIPESPSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVLGVCPLYLDEIRHFLTLCPE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AANAT aralkylamine N-acetyltransferase [ Homo sapiens ]
Official Symbol AANAT
Synonyms AANAT; aralkylamine N-acetyltransferase; arylalkylamine N acetyltransferase; serotonin N-acetyltransferase; serotonin N acetyltransferase; SNAT; serotonin acetylase; arylalkylamine N-acetyltransferase; DSPS;
Gene ID 15
mRNA Refseq NM_001088
Protein Refseq NP_001079
MIM 600950
UniProt ID Q16613

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AANAT Products

Required fields are marked with *

My Review for All AANAT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon