Recombinant Human ABCA3 protein, GST-tagged
| Cat.No. : | ABCA3-1861H |
| Product Overview : | Recombinant Human ABCA3 protein(1606 - 1704 aa), fused to GST tag, was expressed in E. coli. |
| Availability | July 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1606 - 1704 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | GSGYSLRAKVQSEGQQEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEKYGVDDYSVSQISLEQVFLSFAHLQPPTAEEGR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ABCA3 ATP-binding cassette, sub-family A (ABC1), member 3 [ Homo sapiens ] |
| Official Symbol | ABCA3 |
| Synonyms | ABCA3; ATP-binding cassette, sub-family A (ABC1), member 3; ABC3; ATP-binding cassette sub-family A member 3; ABC C; EST111653; LBM180; ABC transporter 3; ABC-C transporter; ATP-binding cassette transporter 3; ABC-C; SMDP3; MGC72201; MGC166979; |
| Gene ID | 21 |
| mRNA Refseq | NM_001089 |
| Protein Refseq | NP_001080 |
| MIM | 601615 |
| UniProt ID | Q99758 |
| ◆ Recombinant Proteins | ||
| ABCA3-0508H | Recombinant Human ABCA3 Protein (Asp1358-Phe1635), N-His-tagged | +Inquiry |
| ABCA3-8114H | Recombinant Human ABCA3 protein, His & T7-tagged | +Inquiry |
| ABCA3-546H | Recombinant Human ABCA3 | +Inquiry |
| ABCA3-1079M | Recombinant Mouse ABCA3 Protein | +Inquiry |
| ABCA3-9205H | Recombinant Human ABCA3, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABCA3-2HCL | Recombinant Human ABCA3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCA3 Products
Required fields are marked with *
My Review for All ABCA3 Products
Required fields are marked with *
