Recombinant Human ABCB10 Protein, GST-Tagged
| Cat.No. : | ABCB10-038H | 
| Product Overview : | Human ABCB10 partial ORF ( NP_036221, 233 a.a. - 311 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 34.43 kDa | 
| AA Sequence : | VYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQASVGISMMFFVS | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | ABCB10 ATP-binding cassette, sub-family B (MDR/TAP), member 10 [ Homo sapiens ] | 
| Official Symbol | ABCB10 | 
| Synonyms | ABCB10; ATP-binding cassette, sub-family B (MDR/TAP), member 10; ATP-binding cassette sub-family B member 10, mitochondrial; ABC transporter 10 protein; ATP binding cassette sub family B member 10; mitochondrial; ATP binding cassette transporter 10; EST20237; M ABC2; mitochondrial ATP binding cassette 2; MTABC2; ATP-binding cassette transporter 10; mitochondrial ATP-binding cassette 2; M-ABC2; | 
| Gene ID | 23456 | 
| mRNA Refseq | NM_012089 | 
| Protein Refseq | NP_036221 | 
| MIM | 605454 | 
| UniProt ID | Q9NRK6 | 
| ◆ Recombinant Proteins | ||
| ABCB10-0141H | Recombinant Human ABCB10 Protein (Leu492-Ala738), N-His-tagged | +Inquiry | 
| ABCB10-9208H | Recombinant Human ABCB10 protein, GST-tagged | +Inquiry | 
| ABCB10-756H | Recombinant Human ABCB10 | +Inquiry | 
| ABCB10-8133H | Recombinant Human ABCB10 protein, His & T7-tagged | +Inquiry | 
| ABCB10-3244H | Recombinant Human ABCB10 protein, His-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCB10 Products
Required fields are marked with *
My Review for All ABCB10 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            