Recombinant Human ABCB10 Protein, GST-Tagged

Cat.No. : ABCB10-038H
Product Overview : Human ABCB10 partial ORF ( NP_036221, 233 a.a. - 311 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown. [provided by RefSeq, Jul 2008]
Molecular Mass : 34.43 kDa
AA Sequence : VYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQASVGISMMFFVS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCB10 ATP-binding cassette, sub-family B (MDR/TAP), member 10 [ Homo sapiens ]
Official Symbol ABCB10
Synonyms ABCB10; ATP-binding cassette, sub-family B (MDR/TAP), member 10; ATP-binding cassette sub-family B member 10, mitochondrial; ABC transporter 10 protein; ATP binding cassette sub family B member 10; mitochondrial; ATP binding cassette transporter 10; EST20237; M ABC2; mitochondrial ATP binding cassette 2; MTABC2; ATP-binding cassette transporter 10; mitochondrial ATP-binding cassette 2; M-ABC2;
Gene ID 23456
mRNA Refseq NM_012089
Protein Refseq NP_036221
MIM 605454
UniProt ID Q9NRK6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCB10 Products

Required fields are marked with *

My Review for All ABCB10 Products

Required fields are marked with *

0
cart-icon