Recombinant Human ABCB10 Protein, GST-Tagged
Cat.No. : | ABCB10-038H |
Product Overview : | Human ABCB10 partial ORF ( NP_036221, 233 a.a. - 311 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 34.43 kDa |
AA Sequence : | VYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQASVGISMMFFVS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABCB10 ATP-binding cassette, sub-family B (MDR/TAP), member 10 [ Homo sapiens ] |
Official Symbol | ABCB10 |
Synonyms | ABCB10; ATP-binding cassette, sub-family B (MDR/TAP), member 10; ATP-binding cassette sub-family B member 10, mitochondrial; ABC transporter 10 protein; ATP binding cassette sub family B member 10; mitochondrial; ATP binding cassette transporter 10; EST20237; M ABC2; mitochondrial ATP binding cassette 2; MTABC2; ATP-binding cassette transporter 10; mitochondrial ATP-binding cassette 2; M-ABC2; |
Gene ID | 23456 |
mRNA Refseq | NM_012089 |
Protein Refseq | NP_036221 |
MIM | 605454 |
UniProt ID | Q9NRK6 |
◆ Recombinant Proteins | ||
ABCB10-8133H | Recombinant Human ABCB10 protein, His & T7-tagged | +Inquiry |
ABCB10-0241H | Recombinant Human ABCB10 Protein (A152-A738), Flag-10×His tagged | +Inquiry |
Abcb10-8134M | Recombinant Mouse Abcb10 protein, His & T7-tagged | +Inquiry |
ABCB10-9208H | Recombinant Human ABCB10 protein, GST-tagged | +Inquiry |
ABCB10-756H | Recombinant Human ABCB10 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCB10 Products
Required fields are marked with *
My Review for All ABCB10 Products
Required fields are marked with *
0
Inquiry Basket