Recombinant Human ABCF1 Protein, GST-Tagged
Cat.No. : | ABCF1-059H |
Product Overview : | Human ABCF1 partial ORF ( NP_001081, 642 a.a. - 739 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the GCN20 subfamily. Unlike other members of the superfamily, this protein lacks the transmembrane domains which are characteristic of most ABC transporters. This protein may be regulated by tumor necrosis factor-alpha and play a role in enhancement of protein synthesis and the inflammation process. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.52 kDa |
AA Sequence : | GEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIES |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABCF1 ATP-binding cassette, sub-family F (GCN20), member 1 [ Homo sapiens ] |
Official Symbol | ABCF1 |
Synonyms | ABCF1; ATP-binding cassette, sub-family F (GCN20), member 1; ABC50; ATP-binding cassette sub-family F member 1; EST123147; TNF-alpha-stimulated ABC protein; TNFalpha-inducible ATP-binding protein; ATP-binding cassette 50 (TNF-alpha stimulated); ABC27; |
Gene ID | 23 |
mRNA Refseq | NM_001025091 |
Protein Refseq | NP_001020262 |
MIM | 603429 |
UniProt ID | Q8NE71 |
◆ Recombinant Proteins | ||
ABCF1-412R | Recombinant Rat ABCF1 Protein | +Inquiry |
ABCF1-183R | Recombinant Rhesus monkey ABCF1 Protein, His-tagged | +Inquiry |
ABCF1-26041TH | Recombinant Human ABCF1, His-tagged | +Inquiry |
ABCF1-12R | Recombinant Rhesus Macaque ABCF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Abcf1-8138M | Recombinant Mouse Abcf1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCF1-7HCL | Recombinant Human ABCF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCF1 Products
Required fields are marked with *
My Review for All ABCF1 Products
Required fields are marked with *