Recombinant Human ABCF1 Protein, GST-Tagged

Cat.No. : ABCF1-059H
Product Overview : Human ABCF1 partial ORF ( NP_001081, 642 a.a. - 739 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the GCN20 subfamily. Unlike other members of the superfamily, this protein lacks the transmembrane domains which are characteristic of most ABC transporters. This protein may be regulated by tumor necrosis factor-alpha and play a role in enhancement of protein synthesis and the inflammation process. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.52 kDa
AA Sequence : GEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIES
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCF1 ATP-binding cassette, sub-family F (GCN20), member 1 [ Homo sapiens ]
Official Symbol ABCF1
Synonyms ABCF1; ATP-binding cassette, sub-family F (GCN20), member 1; ABC50; ATP-binding cassette sub-family F member 1; EST123147; TNF-alpha-stimulated ABC protein; TNFalpha-inducible ATP-binding protein; ATP-binding cassette 50 (TNF-alpha stimulated); ABC27;
Gene ID 23
mRNA Refseq NM_001025091
Protein Refseq NP_001020262
MIM 603429
UniProt ID Q8NE71

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCF1 Products

Required fields are marked with *

My Review for All ABCF1 Products

Required fields are marked with *

0
cart-icon