Recombinant Human ABCF2 Protein, GST-Tagged
| Cat.No. : | ABCF2-060H |
| Product Overview : | Human ABCF2 full-length ORF ( NP_009120.1, 1 a.a. - 623 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the ATP-binding cassette (ABC) transporter superfamily. ATP-binding casette proteins transport various molecules across extra- and intracellular membranes. Alterations in this gene may be involved in cancer progression. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 7. [provided by RefSeq, Jul 2013] |
| Molecular Mass : | 97.7 kDa |
| AA Sequence : | MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ABCF2 ATP-binding cassette, sub-family F (GCN20), member 2 [ Homo sapiens ] |
| Official Symbol | ABCF2 |
| Synonyms | ABCF2; ATP-binding cassette, sub-family F (GCN20), member 2; ATP-binding cassette sub-family F member 2; ABC28; EST133090; HUSSY 18; M ABC1; ABC-type transport protein; Iron inhibited ABC transporter 2; iron-inhibited ABC transporter 2; M-ABC1; HUSSY18; HUSSY-18; DKFZp586K1823; |
| Gene ID | 10061 |
| mRNA Refseq | NM_005692 |
| Protein Refseq | NP_005683 |
| MIM | 612510 |
| UniProt ID | Q9UG63 |
| ◆ Recombinant Proteins | ||
| ABCF2-061H | Recombinant Human ABCF2 Protein, GST-Tagged | +Inquiry |
| Abcf2-1463M | Recombinant Mouse Abcf2 Protein, Myc/DDK-tagged | +Inquiry |
| ABCF2-1699C | Recombinant Chicken ABCF2 | +Inquiry |
| ABCF2-205M | Recombinant Mouse ABCF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ABCF2-9226H | Recombinant Human ABCF2, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABCF2-9144HCL | Recombinant Human ABCF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCF2 Products
Required fields are marked with *
My Review for All ABCF2 Products
Required fields are marked with *
