Recombinant Human ABCG1 Protein, GST-Tagged

Cat.No. : ABCG1-064H
Product Overview : Human ABCG1 partial ORF ( AAH29158, 21 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified. [provided by RefSeq, Jul 2008]
Molecular Mass : 37.73 kDa
AA Sequence : AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCG1 ATP-binding cassette, sub-family G (WHITE), member 1 [ Homo sapiens ]
Official Symbol ABCG1
Synonyms ABCG1; ATP-binding cassette, sub-family G (WHITE), member 1; ATP-binding cassette sub-family G member 1; ABC8; ATP binding cassette transporter 8; ABC transporter 8; homolog of Drosophila white; ATP-binding cassette transporter 8; ATP-binding cassette transporter member 1 of subfamily G; white protein homolog (ATP-binding cassette transporter 8); WHITE1; MGC34313;
Gene ID 9619
mRNA Refseq NM_004915
Protein Refseq NP_004906
MIM 603076
UniProt ID P45844

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCG1 Products

Required fields are marked with *

My Review for All ABCG1 Products

Required fields are marked with *

0
cart-icon