Recombinant Human ABCG1 Protein, GST-Tagged
Cat.No. : | ABCG1-064H |
Product Overview : | Human ABCG1 partial ORF ( AAH29158, 21 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABCG1 ATP-binding cassette, sub-family G (WHITE), member 1 [ Homo sapiens ] |
Official Symbol | ABCG1 |
Synonyms | ABCG1; ATP-binding cassette, sub-family G (WHITE), member 1; ATP-binding cassette sub-family G member 1; ABC8; ATP binding cassette transporter 8; ABC transporter 8; homolog of Drosophila white; ATP-binding cassette transporter 8; ATP-binding cassette transporter member 1 of subfamily G; white protein homolog (ATP-binding cassette transporter 8); WHITE1; MGC34313; |
Gene ID | 9619 |
mRNA Refseq | NM_004915 |
Protein Refseq | NP_004906 |
MIM | 603076 |
UniProt ID | P45844 |
◆ Recombinant Proteins | ||
ABCG1-063H | Recombinant Human ABCG1 Protein, GST-Tagged | +Inquiry |
RFL8471DF | Recombinant Full Length Dictyostelium Discoideum Abc Transporter G Family Member 1(Abcg1) Protein, His-Tagged | +Inquiry |
ABCG1-0205H | Recombinant Human ABCG1 Protein (Met1-His353), N-His-tagged | +Inquiry |
ABCG1-064H | Recombinant Human ABCG1 Protein, GST-Tagged | +Inquiry |
ABCG1-2644H | Recombinant Human ABCG1 Protein (1-426 aa), His-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCG1 Products
Required fields are marked with *
My Review for All ABCG1 Products
Required fields are marked with *
0
Inquiry Basket