Recombinant Human ABHD12B Protein, GST-Tagged
Cat.No. : | ABHD12B-074H |
Product Overview : | Human ABHD12B full-length ORF ( NP_853511.2, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ABHD12B (Abhydrolase Domain Containing 12B) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity and serine-type peptidase activity. An important paralog of this gene is ABHD12. |
Molecular Mass : | 55 kDa |
AA Sequence : | MLGIWHTVPSCRGEDAKGKDCCWYEAALRDGNPIIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTGKPTEEGLTTDAICVYEWTKARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIIFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQWS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABHD12B abhydrolase domain containing 12B [ Homo sapiens ] |
Official Symbol | ABHD12B |
Synonyms | BEM46L3; C14orf29; c14_5314 |
Gene ID | 145447 |
mRNA Refseq | NM_181814 |
Protein Refseq | NP_861535 |
UniProt ID | Q7Z5M8 |
◆ Recombinant Proteins | ||
ABHD12B-874HF | Recombinant Full Length Human ABHD12B Protein, GST-tagged | +Inquiry |
ABHD12B-3038H | Recombinant Human ABHD12B, His-tagged | +Inquiry |
ABHD12B-074H | Recombinant Human ABHD12B Protein, GST-Tagged | +Inquiry |
ABHD12B-236H | Recombinant Human ABHD12B, His-tagged | +Inquiry |
ABHD12B-9235H | Recombinant Human ABHD12B, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD12B-9139HCL | Recombinant Human ABHD12B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD12B Products
Required fields are marked with *
My Review for All ABHD12B Products
Required fields are marked with *
0
Inquiry Basket