Recombinant Human ABHD12B Protein, GST-Tagged
| Cat.No. : | ABHD12B-074H |
| Product Overview : | Human ABHD12B full-length ORF ( NP_853511.2, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ABHD12B (Abhydrolase Domain Containing 12B) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity and serine-type peptidase activity. An important paralog of this gene is ABHD12. |
| Molecular Mass : | 55 kDa |
| AA Sequence : | MLGIWHTVPSCRGEDAKGKDCCWYEAALRDGNPIIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTGKPTEEGLTTDAICVYEWTKARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIIFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQWS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ABHD12B abhydrolase domain containing 12B [ Homo sapiens ] |
| Official Symbol | ABHD12B |
| Synonyms | BEM46L3; C14orf29; c14_5314 |
| Gene ID | 145447 |
| mRNA Refseq | NM_181814 |
| Protein Refseq | NP_861535 |
| UniProt ID | Q7Z5M8 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD12B Products
Required fields are marked with *
My Review for All ABHD12B Products
Required fields are marked with *
