Recombinant Human ABHD12B Protein, GST-Tagged

Cat.No. : ABHD12B-074H
Product Overview : Human ABHD12B full-length ORF ( NP_853511.2, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ABHD12B (Abhydrolase Domain Containing 12B) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity and serine-type peptidase activity. An important paralog of this gene is ABHD12.
Molecular Mass : 55 kDa
AA Sequence : MLGIWHTVPSCRGEDAKGKDCCWYEAALRDGNPIIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTGKPTEEGLTTDAICVYEWTKARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIIFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQWS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABHD12B abhydrolase domain containing 12B [ Homo sapiens ]
Official Symbol ABHD12B
Synonyms BEM46L3; C14orf29; c14_5314
Gene ID 145447
mRNA Refseq NM_181814
Protein Refseq NP_861535
UniProt ID Q7Z5M8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABHD12B Products

Required fields are marked with *

My Review for All ABHD12B Products

Required fields are marked with *

0
cart-icon
0
compare icon