Recombinant Human ABHD14B Protein, GST-Tagged

Cat.No. : ABHD14B-077H
Product Overview : Human ABHD14B full-length ORF ( NP_116139.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ABHD14B (Abhydrolase Domain Containing 14B) is a Protein Coding gene. Among its related pathways are Metabolism and Cytochrome P450 - arranged by substrate type. GO annotations related to this gene include hydrolase activity. An important paralog of this gene is ABHD14A.
Molecular Mass : 48.7 kDa
AA Sequence : MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABHD14B abhydrolase domain containing 14B [ Homo sapiens ]
Official Symbol ABHD14B
Synonyms ABHD14B; abhydrolase domain containing 14B; abhydrolase domain-containing protein 14B; CIB; MGC15429; CCG1-interacting factor B; cell cycle gene 1-interacting factor B;
Gene ID 84836
mRNA Refseq NM_001146314
Protein Refseq NP_001139786
UniProt ID Q96IU4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABHD14B Products

Required fields are marked with *

My Review for All ABHD14B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon