Recombinant Human ABHD14B Protein, GST-Tagged
Cat.No. : | ABHD14B-077H |
Product Overview : | Human ABHD14B full-length ORF ( NP_116139.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ABHD14B (Abhydrolase Domain Containing 14B) is a Protein Coding gene. Among its related pathways are Metabolism and Cytochrome P450 - arranged by substrate type. GO annotations related to this gene include hydrolase activity. An important paralog of this gene is ABHD14A. |
Molecular Mass : | 48.7 kDa |
AA Sequence : | MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABHD14B abhydrolase domain containing 14B [ Homo sapiens ] |
Official Symbol | ABHD14B |
Synonyms | ABHD14B; abhydrolase domain containing 14B; abhydrolase domain-containing protein 14B; CIB; MGC15429; CCG1-interacting factor B; cell cycle gene 1-interacting factor B; |
Gene ID | 84836 |
mRNA Refseq | NM_001146314 |
Protein Refseq | NP_001139786 |
UniProt ID | Q96IU4 |
◆ Recombinant Proteins | ||
ABHD14B-077H | Recombinant Human ABHD14B Protein, GST-Tagged | +Inquiry |
ABHD14B-1392H | Recombinant Human ABHD14B protein, His-tagged | +Inquiry |
ABHD14B-17R | Recombinant Rhesus Macaque ABHD14B Protein, His (Fc)-Avi-tagged | +Inquiry |
ABHD14B-9238H | Recombinant Human ABHD14B protein, His-tagged | +Inquiry |
ABHD14B-877HF | Recombinant Full Length Human ABHD14B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD14B-9136HCL | Recombinant Human ABHD14B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD14B Products
Required fields are marked with *
My Review for All ABHD14B Products
Required fields are marked with *