Recombinant Human ABHD14B protein, His-tagged
Cat.No. : | ABHD14B-9238H |
Product Overview : | Recombinant Human ABHD14B protein(1-210 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-210 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ |
Gene Name | ABHD14B abhydrolase domain containing 14B [ Homo sapiens ] |
Official Symbol | ABHD14B |
Synonyms | ABHD14B; abhydrolase domain containing 14B; abhydrolase domain-containing protein 14B; CIB; MGC15429; CCG1-interacting factor B; cell cycle gene 1-interacting factor B; |
Gene ID | 84836 |
mRNA Refseq | NM_001146314 |
Protein Refseq | NP_001139786 |
UniProt ID | Q96IU4 |
◆ Recombinant Proteins | ||
ABHD14B-420R | Recombinant Rat ABHD14B Protein | +Inquiry |
ABHD14B-1392H | Recombinant Human ABHD14B protein, His-tagged | +Inquiry |
ABHD14B-1394H | Recombinant Human Dual Abhydrolase domain containing 14B, His-tagged | +Inquiry |
ABHD14B-877HF | Recombinant Full Length Human ABHD14B Protein, GST-tagged | +Inquiry |
ABHD14B-1521H | Recombinant Human ABHD14B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD14B-9136HCL | Recombinant Human ABHD14B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD14B Products
Required fields are marked with *
My Review for All ABHD14B Products
Required fields are marked with *