Recombinant Human ABHD17B Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ABHD17B-3643H |
| Product Overview : | FAM108B1 MS Standard C13 and N15-labeled recombinant protein (NP_057098) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | ABHD17B (Abhydrolase Domain Containing 17B, Depalmitoylase) is a Protein Coding gene. Diseases associated with ABHD17B include Acrofacial Dysostosis 1, Nager Type. Gene Ontology (GO) annotations related to this gene include hydrolase activity and serine-type peptidase activity. An important paralog of this gene is ABHD17A. |
| Molecular Mass : | 32.6 kDa |
| AA Sequence : | MNNLSFSELCCLFCCPPCPGKIASKLAFLPPDPTYTLMCDESGSRWTLHLSERADWQYSSREKDAIECFMTRTSKGNRIACMFVRCSPNAKYTLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLAARYESAAVILHSPLTSGMRVAFPDTKKTYCFDAFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPLWVEGAGHNDVELYGQYLERLKQFVSQELVQKHKEGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ABHD17B abhydrolase domain containing 17B, depalmitoylase [ Homo sapiens (human) ] |
| Official Symbol | ABHD17B |
| Synonyms | ABHD17B; abhydrolase domain containing 17B, depalmitoylase; CGI-67; C9orf77; FAM108B1; alpha/beta hydrolase domain-containing protein 17B; abhydrolase domain-containing protein 17B; abhydrolase domain-containing protein FAM108B1; epididymis secretory sperm binding protein; family with sequence similarity 108, member B1; protein ABHD17B; EC 3.1.2.22 |
| Gene ID | 51104 |
| mRNA Refseq | NM_016014 |
| Protein Refseq | NP_057098 |
| MIM | 617943 |
| UniProt ID | Q5VST6 |
| ◆ Recombinant Proteins | ||
| ABHD17B-3670H | Recombinant Human ABHD17B Protein, GST-tagged | +Inquiry |
| ABHD17B-3073C | Recombinant Chicken ABHD17B | +Inquiry |
| ABHD17B-4464HF | Recombinant Full Length Human ABHD17B Protein, GST-tagged | +Inquiry |
| ABHD17B-676H | Recombinant Human ABHD17B Protein, MYC/DDK-tagged | +Inquiry |
| ABHD17B-840Z | Recombinant Zebrafish ABHD17B | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABHD17B-262HCL | Recombinant Human ABHD17B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD17B Products
Required fields are marked with *
My Review for All ABHD17B Products
Required fields are marked with *
