Recombinant Human ABHD4 Protein, GST-Tagged
Cat.No. : | ABHD4-078H |
Product Overview : | Human ABHD4 full-length ORF ( NP_071343.2, 1 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ABHD4 (Abhydrolase Domain Containing 4) is a Protein Coding gene. Among its related pathways are Metabolism and Glycerophospholipid biosynthesis. GO annotations related to this gene include hydrolase activity and 1-alkyl-2-acetylglycerophosphocholine esterase activity. An important paralog of this gene is ABHD5. |
Molecular Mass : | 65.2 kDa |
AA Sequence : | MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABHD4 abhydrolase domain containing 4 [ Homo sapiens ] |
Official Symbol | ABHD4 |
Synonyms | ABHD4; abhydrolase domain containing 4; abhydrolase domain-containing protein 4; FLJ12816; alpha/beta-hydrolase 4; lyso-N-acylphosphatidylethanolamine lipase; ABH4; |
Gene ID | 63874 |
mRNA Refseq | NM_022060 |
Protein Refseq | NP_071343 |
UniProt ID | Q8TB40 |
◆ Recombinant Proteins | ||
ABHD4-191R | Recombinant Rhesus monkey ABHD4 Protein, His-tagged | +Inquiry |
ABHD4-878HF | Recombinant Full Length Human ABHD4 Protein, GST-tagged | +Inquiry |
ABHD4-078H | Recombinant Human ABHD4 Protein, GST-Tagged | +Inquiry |
ABHD4-20R | Recombinant Rhesus Macaque ABHD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABHD4-2384Z | Recombinant Zebrafish ABHD4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD4-675HCL | Recombinant Human ABHD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD4 Products
Required fields are marked with *
My Review for All ABHD4 Products
Required fields are marked with *