Recombinant Human ABHD6 Protein, C-Myc/DDK-tagged

Cat.No. : ABHD6-11H
Product Overview : Recombinant protein of human abhydrolase domain containing 6 (ABHD6) with a C-Myc/DDK tag was expressed in HEK293T.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Enables acylglycerol lipase activity. Involved in acylglycerol catabolic process. Predicted to be located in late endosome membrane and lysosomal membrane. Predicted to be integral component of membrane. Predicted to be part of AMPA glutamate receptor complex. Predicted to be active in GABA-ergic synapse; glutamatergic synapse; and mitochondrion. Predicted to be integral component of postsynaptic membrane.
Molecular Mass : 38.2 kDa
AA Sequence : MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 μg/mL as determined by microplate BCA method
Storage Buffer : 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Gene Name ABHD6 abhydrolase domain containing 6, acylglycerol lipase [ Homo sapiens (human) ]
Official Symbol ABHD6
Synonyms ABHD6; abhydrolase domain containing 6, acylglycerol lipase; monoacylglycerol lipase ABHD6; 2-arachidonoylglycerol hydrolase; abhydrolase domain-containing protein 6; lipase protein; EC 3.1.1.23
Gene ID 57406
mRNA Refseq NM_020676
Protein Refseq NP_065727
MIM 616966
UniProt ID Q9BV23

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABHD6 Products

Required fields are marked with *

My Review for All ABHD6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon